DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and C10G8.2

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_504418.1 Gene:C10G8.2 / 182501 WormBaseID:WBGene00015681 Length:208 Species:Caenorhabditis elegans


Alignment Length:59 Identity:17/59 - (28%)
Similarity:27/59 - (45%) Gaps:2/59 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PICGQPPAVNGNDFIKC-AGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80
            |.|.: ...:.|...|| ..|..||.:.....:|..|.:.||...:|.|::|::|...|
 Worm    21 PRCSK-SIFDSNLTAKCEKSSTIKFHFDQSTGLCMNFRWDGCKDQENKFDSLQECASTC 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 15/56 (27%)
C10G8.2NP_504418.1 Kunitz_BPTI <38..78 CDD:425421 11/39 (28%)

Return to query results.
Submit another query.