DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and B0222.5

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_505373.1 Gene:B0222.5 / 181860 WormBaseID:WBGene00015056 Length:369 Species:Caenorhabditis elegans


Alignment Length:75 Identity:23/75 - (30%)
Similarity:33/75 - (44%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPICGQP-PAVNGNDFIKCAGSFEKFSYYPHINV--CQKFEYGGCFGNDNSFNTLEKCHKKCKLD 83
            |...|:| .|.|.|....|..:.....|:..:..  |..||:.||.||.||:.|..:|:..|.|.
 Worm   180 DQPIGKPWCASNRNAGHTCNQNKTSIRYWFDVETFQCFPFEHKGCGGNQNSYRTSSECYFDCVLQ 244

  Fly    84 WNTLYFLNCA 93
                .:.:||
 Worm   245 ----DYFSCA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 18/58 (31%)
B0222.5NP_505373.1 TY 22..84 CDD:238114
TY 87..154 CDD:238114
KU 186..241 CDD:197529 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.