DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and F22E12.1

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:79 Identity:25/79 - (31%)
Similarity:42/79 - (53%) Gaps:9/79 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVLGCLLLALETVGLCLKDPICGQPPAVNGNDFIKCAGSFE-KFSYYPHINVCQKFEYGGCFGN 66
            :::.||..:..:.:   |.:|.|...|     |...|...|. |:.|..:.:.|::|.||||.||
 Worm     6 ILLFGCTAVNSQQL---LSNPKCNHWP-----DRGTCELDFHVKWYYDRYDHRCRRFFYGGCEGN 62

  Fly    67 DNSFNTLEKCHKKC 80
            :|.|::||:|..:|
 Worm    63 ENRFDSLEECSSQC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 20/56 (36%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633 20/55 (36%)
KU 85..137 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.