DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and mec-9

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001256153.1 Gene:mec-9 / 179382 WormBaseID:WBGene00003173 Length:838 Species:Caenorhabditis elegans


Alignment Length:64 Identity:20/64 - (31%)
Similarity:31/64 - (48%) Gaps:10/64 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QPPAVNGNDFIKCAGSFE--KFSYY-------PHINVCQKFEYGGCFGNDNSFNTLEKCHKKCK 81
            :|..|..|:.| |....:  ...||       ..:..|::|.||||.|..|.|::.::|.|:||
 Worm    25 EPVFVKNNEDI-CLEDVDPGPCQYYQVQWFWDKQVEECKEFHYGGCMGTKNRFSSKQQCVKQCK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 18/61 (30%)
mec-9NP_001256153.1 Kunitz_BPTI 35..87 CDD:425421 15/52 (29%)
Kunitz_BPTI 100..154 CDD:425421
EGF_CA 199..229 CDD:429571
EGF_3 252..277 CDD:463759
EGF_3 283..318 CDD:463759
KU 323..381 CDD:197529
KU <408..449 CDD:197529
KU 460..516 CDD:197529
EGF_CA 550..586 CDD:238011
EGF 639..671 CDD:394967
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.