DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and C49H3.16

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001255308.1 Gene:C49H3.16 / 13196868 WormBaseID:WBGene00219436 Length:206 Species:Caenorhabditis elegans


Alignment Length:68 Identity:20/68 - (29%)
Similarity:33/68 - (48%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCKLDWNTLY 88
            :|..|| |.|:    |:.:...:.|......|::|.:.|| ||.|.|.:..:|.:.|  ..|:|:
 Worm   146 VCSLPP-VTGS----CSRARIMWYYDNESRRCERFSWSGC-GNQNRFASKMQCEQTC--SQNSLF 202

  Fly    89 FLN 91
            ..|
 Worm   203 KRN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 16/55 (29%)
C49H3.16NP_001255308.1 PHA03247 <31..126 CDD:223021
PRK10856 <60..>106 CDD:236776
Kunitz-type 147..196 CDD:438633 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.