| Sequence 1: | NP_001245858.1 | Gene: | CG43165 / 12798550 | FlyBaseID: | FBgn0262721 | Length: | 95 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_783165.1 | Gene: | WFIKKN2 / 124857 | HGNCID: | 30916 | Length: | 576 | Species: | Homo sapiens |
| Alignment Length: | 74 | Identity: | 23/74 - (31%) |
|---|---|---|---|
| Similarity: | 33/74 - (44%) | Gaps: | 12/74 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 CLLLALETVGLCLKDPICG-QPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFN 71
Fly 72 TLEKCHKKC 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43165 | NP_001245858.1 | Kunitz-type | 24..80 | CDD:444694 | 18/56 (32%) |
| WFIKKN2 | NP_783165.1 | WAP | 42..91 | CDD:459672 | |
| KAZAL_FS | 138..174 | CDD:238052 | |||
| IgI_3_WFIKKN-like | 210..304 | CDD:409422 | |||
| Ig strand A | 210..213 | CDD:409422 | |||
| Ig strand A' | 218..221 | CDD:409422 | |||
| Ig strand B | 226..233 | CDD:409422 | |||
| Ig strand C | 240..245 | CDD:409422 | |||
| Ig strand C' | 246..248 | CDD:409422 | |||
| Ig strand D | 250..255 | CDD:409422 | |||
| Ig strand E | 263..269 | CDD:409422 | |||
| Ig strand F | 283..291 | CDD:409422 | |||
| Ig strand G | 294..304 | CDD:409422 | |||
| Kunitz_WFIKKN_1-like | 327..378 | CDD:438648 | 2/10 (20%) | ||
| Kunitz_WFIKKN_2-like | 385..437 | CDD:438649 | 19/56 (34%) | ||
| NTR_WFIKKN | 455..563 | CDD:239630 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||