| Sequence 1: | NP_001245858.1 | Gene: | CG43165 / 12798550 | FlyBaseID: | FBgn0262721 | Length: | 95 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_444514.1 | Gene: | WFIKKN1 / 117166 | HGNCID: | 30912 | Length: | 548 | Species: | Homo sapiens |
| Alignment Length: | 52 | Identity: | 21/52 - (40%) |
|---|---|---|---|
| Similarity: | 28/52 - (53%) | Gaps: | 4/52 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 PAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43165 | NP_001245858.1 | Kunitz-type | 24..80 | CDD:444694 | 20/50 (40%) |
| WFIKKN1 | NP_444514.1 | WAP | 29..78 | CDD:459672 | |
| KAZAL_FS | 120..155 | CDD:238052 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 164..184 | ||||
| IgI_3_WFIKKN-like | 186..280 | CDD:409422 | |||
| Ig strand A | 186..189 | CDD:409422 | |||
| Ig strand A' | 194..197 | CDD:409422 | |||
| Ig strand B | 202..209 | CDD:409422 | |||
| Ig strand C | 216..221 | CDD:409422 | |||
| Ig strand C' | 222..224 | CDD:409422 | |||
| Ig strand D | 226..231 | CDD:409422 | |||
| Ig strand E | 239..245 | CDD:409422 | |||
| Ig strand F | 259..267 | CDD:409422 | |||
| Ig strand G | 270..280 | CDD:409422 | |||
| Kunitz-type | 298..351 | CDD:444694 | |||
| Kunitz_WFIKKN_2-like | 358..410 | CDD:438649 | 21/52 (40%) | ||
| NTR_WFIKKN | 427..537 | CDD:239630 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||