| Sequence 1: | NP_001245858.1 | Gene: | CG43165 / 12798550 | FlyBaseID: | FBgn0262721 | Length: | 95 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_031469.1 | Gene: | Ambp / 11699 | MGIID: | 88002 | Length: | 349 | Species: | Mus musculus |
| Alignment Length: | 43 | Identity: | 16/43 - (37%) |
|---|---|---|---|
| Similarity: | 25/43 - (58%) | Gaps: | 0/43 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 CAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCK 81 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43165 | NP_001245858.1 | Kunitz-type | 24..80 | CDD:444694 | 15/40 (38%) |
| Ambp | NP_031469.1 | lipocalin_A1M-like | 27..189 | CDD:381193 | |
| Kunitz_bikunin_1-like | 228..281 | CDD:438639 | 15/41 (37%) | ||
| Kunitz_bikunin_2-like | 284..337 | CDD:438640 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||