DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and LOC100485348

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:XP_031750923.1 Gene:LOC100485348 / 100485348 XenbaseID:XB-GENE-29077767 Length:206 Species:Xenopus tropicalis


Alignment Length:59 Identity:17/59 - (28%)
Similarity:20/59 - (33%) Gaps:5/59 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80
            |.:|..|....     .|.....::.|......|..|.|.||.||.|.|...|.|...|
 Frog    87 DAVCDLPMESG-----PCLALIPQWYYNKERGACHSFLYSGCQGNGNRFENKENCTTLC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 15/55 (27%)
LOC100485348XP_031750923.1 Kunitz-type 23..75 CDD:444694
Kunitz-type 87..140 CDD:444694 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.