DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and si:dkeyp-73b11.8

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001373612.1 Gene:si:dkeyp-73b11.8 / 100333708 ZFINID:ZDB-GENE-131120-176 Length:230 Species:Danio rerio


Alignment Length:58 Identity:18/58 - (31%)
Similarity:31/58 - (53%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80
            |:.|:...|...:..:|.|.:.::.|.|..:.|:.|.:.||.||.|.|.:|.:|:..|
Zfish    86 PMDGKQICVLPREPGQCFGHYLRYYYSPEHHTCKPFYWTGCVGNGNRFLSLNRCNATC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 16/55 (29%)
si:dkeyp-73b11.8NP_001373612.1 Kunitz_conkunitzin 27..77 CDD:438636
Kunitz_BPTI 92..143 CDD:425421 15/50 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.