DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and col28a2a

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001153314.2 Gene:col28a2a / 100294690 ZFINID:ZDB-GENE-030131-4444 Length:1208 Species:Danio rerio


Alignment Length:61 Identity:25/61 - (40%)
Similarity:31/61 - (50%) Gaps:5/61 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCKL 82
            ||.| |...|.|:    |.....::.|....|.|.:|.||||.||||.|:|.|:|...|.|
Zfish  1149 DPRC-QLSFVQGS----CRNYVIRWYYEKQSNSCAQFWYGGCDGNDNRFHTEEECKTTCVL 1204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 21/55 (38%)
col28a2aNP_001153314.2 VWA 61..242 CDD:459670
gly_rich_SclB <260..>560 CDD:468478
gly_rich_SclB <511..>795 CDD:468478
VWA 816..995 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1152..1202 CDD:438671 21/54 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.