DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43342 and Gpdh1

DIOPT Version :9

Sequence 1:NP_001247238.1 Gene:CG43342 / 12798510 FlyBaseID:FBgn0263047 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001260112.1 Gene:Gpdh1 / 33824 FlyBaseID:FBgn0001128 Length:360 Species:Drosophila melanogaster


Alignment Length:87 Identity:18/87 - (20%)
Similarity:37/87 - (42%) Gaps:15/87 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TTSENGDNEEQKASYIKEDHIETERKSLLLIKRNNVALQKRQLPYSRPTPQNRQELVES--IEQD 73
            ||...|.|.....:::      |..|::..:::..:..||.|.|   ||.:....::::  :|..
  Fly   264 TTCYGGRNRRVSEAFV------TSGKTIEELEKEMLNGQKLQGP---PTAEEVNYMLKNKGLEDK 319

  Fly    74 RKVLSAYFKRLSSQRDEVTSPN 95
            ..:.:|..|..::|    ..||
  Fly   320 FPLFTAIHKICTNQ----LKPN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43342NP_001247238.1 BESS 109..143 CDD:281011
Gpdh1NP_001260112.1 glycerol3P_DH 6..343 CDD:274551 18/87 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S475
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.