DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43342 and gpdh-1

DIOPT Version :9

Sequence 1:NP_001247238.1 Gene:CG43342 / 12798510 FlyBaseID:FBgn0263047 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_493454.1 Gene:gpdh-1 / 173272 WormBaseID:WBGene00009824 Length:374 Species:Caenorhabditis elegans


Alignment Length:65 Identity:20/65 - (30%)
Similarity:30/65 - (46%) Gaps:9/65 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TTSENGDNEEQKASYIKEDHIETERKSLLLIKRNNVALQKRQLPYSRPTPQNRQELVESIEQDRK 75
            ||...|.|.:...::||.|      |.|.:|::..:..|..|.|   ||.|:..|::|..|...|
 Worm   288 TTCYGGRNRKVAEAFIKSD------KPLRVIEQELLKGQSAQGP---PTAQDVYEMLEINEISEK 343

  Fly    76  75
             Worm   344  343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43342NP_001247238.1 BESS 109..143 CDD:281011
gpdh-1NP_493454.1 glycerol3P_DH 23..367 CDD:274551 20/65 (31%)
NAD_Gly3P_dh_N 23..199 CDD:279543
NAD_Gly3P_dh_C 223..356 CDD:284817 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S475
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.