Sequence 1: | NP_001246886.1 | Gene: | CG43329 / 12798461 | FlyBaseID: | FBgn0263034 | Length: | 194 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246885.1 | Gene: | CG43330 / 12798460 | FlyBaseID: | FBgn0263035 | Length: | 170 | Species: | Drosophila melanogaster |
Alignment Length: | 132 | Identity: | 33/132 - (25%) |
---|---|---|---|
Similarity: | 55/132 - (41%) | Gaps: | 17/132 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 LLQILAIHSTGNCTF-------AKNVTLKFVCKGNVPKDMYTMFRDNRAPPDTPYSVWQTEEDDS 75
Fly 76 ALLVSFYTTMFPNYDTINLQEGEMDLGQFFLATKGRNTNDL-LFVTPSTLHCFPFGLRYTNELKR 139
Fly 140 HC 141 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45447253 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |