DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43329 and CG43330

DIOPT Version :9

Sequence 1:NP_001246886.1 Gene:CG43329 / 12798461 FlyBaseID:FBgn0263034 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001246885.1 Gene:CG43330 / 12798460 FlyBaseID:FBgn0263035 Length:170 Species:Drosophila melanogaster


Alignment Length:132 Identity:33/132 - (25%)
Similarity:55/132 - (41%) Gaps:17/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLQILAIHSTGNCTF-------AKNVTLKFVCKGNVPKDMYTMFRDNRAPPDTPYSVWQTEEDDS 75
            ||.|..:.|:...:|       ...:....|||.....|:...:||.....|.||.:|.......
  Fly     7 LLPIAFLLSSSEASFDSCYFMLENEIPFTLVCKAEYSTDLKLSYRDIWLSADVPYWLWWRRLPSV 71

  Fly    76 ALLVSFYTTMFPNYDTINLQEGEMDLGQFFLATKGRNTNDL-LFVTPSTLHCFPFGLRYTNELKR 139
            .||:|||.:.....:.::|     .|.....|    ::::| :.:.|.::|||.|...|..:|.:
  Fly    72 ELLISFYESPISPCENVSL-----SLNCLHCA----DSDELGIHIRPESIHCFDFSFSYVRDLMK 127

  Fly   140 HC 141
            ||
  Fly   128 HC 129



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.