DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43330 and CG43329

DIOPT Version :10

Sequence 1:NP_001246885.1 Gene:CG43330 / 12798460 FlyBaseID:FBgn0263035 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001246886.1 Gene:CG43329 / 12798461 FlyBaseID:FBgn0263034 Length:194 Species:Drosophila melanogaster


Alignment Length:132 Identity:33/132 - (25%)
Similarity:55/132 - (41%) Gaps:17/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLPIAFLLSSSEASFDSCYFMLENEIPFTLVCKAEYSTDLKLSYRDIWLSADVPYWLWWRRLPSV 71
            ||.|..:.|:...:|       ...:....|||.....|:...:||.....|.||.:|.......
  Fly    18 LLQILAIHSTGNCTF-------AKNVTLKFVCKGNVPKDMYTMFRDNRAPPDTPYSVWQTEEDDS 75

  Fly    72 ELLISFYESPISPCENVSL-----SLNCLHCA----DSDELGIHIRPESIHCFDFSFSYVRDLMK 127
            .||:|||.:.....:.::|     .|.....|    ::::| :.:.|.::|||.|...|..:|.:
  Fly    76 ALLVSFYTTMFPNYDTINLQEGEMDLGQFFLATKGRNTNDL-LFVTPSTLHCFPFGLRYTNELKR 139

  Fly   128 HC 129
            ||
  Fly   140 HC 141

Return to query results.
Submit another query.