DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43330 and CG43331

DIOPT Version :9

Sequence 1:NP_001246885.1 Gene:CG43330 / 12798460 FlyBaseID:FBgn0263035 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001246884.1 Gene:CG43331 / 12798459 FlyBaseID:FBgn0263036 Length:253 Species:Drosophila melanogaster


Alignment Length:151 Identity:44/151 - (29%)
Similarity:69/151 - (45%) Gaps:16/151 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PIAFLL-------SSSEASFDSCYFMLENEIPFTLVCKAEYSTDLKLSYRDIWLSADVPYWLWWR 66
            |::|||       .|:.....:|.| ||..| ...||.:.|..:::|.::|...:...||.:|.|
  Fly    66 PVSFLLLLLILGPVSAACEDQNCTF-LEGYI-LQYVCHSSYIEEIRLQHKDRIPAIGTPYAIWKR 128

  Fly    67 ---RLPSVELLISFYESPISPCENVSLSLNCLHCADSDELGIHIRPESIHCFDFSFSYVRDLMKH 128
               ..||. ||||||:||:..|..|.:.....:|...:.:..:...|.:||.::.|.|...|...
  Fly   129 PDTHDPSY-LLISFYDSPLFSCYTVVMHNGKFYCDGRNFIEPNTEVEQMHCLNYPFHYTLHLYNA 192

  Fly   129 CGLSPATKFD---RVAILYAR 146
            |...|.::..   .|||.|.:
  Fly   193 CAKKPCSEGSPPIAVAIAYMK 213



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447254
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C4BJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019856
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.