DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43058 and AT3G07200

DIOPT Version :10

Sequence 1:NP_001246302.1 Gene:CG43058 / 12798445 FlyBaseID:FBgn0262360 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_187376.1 Gene:AT3G07200 / 819908 AraportID:AT3G07200 Length:182 Species:Arabidopsis thaliana


Alignment Length:117 Identity:38/117 - (32%)
Similarity:53/117 - (45%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SQMQCHCRACRHNVPNEIIDLCSPQKQPVKRLRSDLGDSD------------------EP-YMCP 48
            :|.:...|:.|..  ::::|:.|.......|.|||....|                  || :.||
plant    66 AQAKNKSRSARRG--SQVVDVESAGANRSTRRRSDQTSVDSVELNKPRKSKAVAPPVEEPKFSCP 128

  Fly    49 ICMENVRRRQPAATPCGHVFCYDCIQKAIGDYKKCPMCNKKIMYKQLTRIFL 100
            ||:  ....|..:|.|||:||..||:.|:....|||.|.|||..|.|.|:||
plant   129 ICL--CPFTQEVSTKCGHIFCKKCIKNALSLQAKCPTCRKKITVKDLIRVFL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43058NP_001246302.1 RING_Ubox 47..99 CDD:473075 24/51 (47%)
AT3G07200NP_187376.1 RING_Ubox 126..177 CDD:473075 24/52 (46%)

Return to query results.
Submit another query.