DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43058 and RNF4

DIOPT Version :10

Sequence 1:NP_001246302.1 Gene:CG43058 / 12798445 FlyBaseID:FBgn0262360 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_002929.1 Gene:RNF4 / 6047 HGNCID:10067 Length:190 Species:Homo sapiens


Alignment Length:147 Identity:36/147 - (24%)
Similarity:52/147 - (35%) Gaps:64/147 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NEIIDLCSPQKQPV-----------------------KRLRSDLGDS------DEP-------YM 46
            :||:||.....:||                       :||..|..||      ||.       |:
Human    44 DEIVDLTCESLEPVVVDLTHNDSVVIVDERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYV 108

  Fly    47 -----------------------CPICMENVRR-----RQPAATPCGHVFCYDCIQKAIGDYKKC 83
                                   |||||:....     |...:|.||||||..|::.::.:...|
Human   109 TTHTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTC 173

  Fly    84 PMCNKKIMYKQLTRIFL 100
            |.|.|||.:|:...|::
Human   174 PTCRKKINHKRYHPIYI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43058NP_001246302.1 RING_Ubox 47..99 CDD:473075 21/56 (38%)
RNF4NP_002929.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Required for ubiquitination activity. /evidence=ECO:0000250|UniProtKB:Q9QZS2 1..16
Mediates interaction with TRPS1. /evidence=ECO:0000250|UniProtKB:Q9QZS2 4..61 6/16 (38%)
SUMO interaction motif 1. /evidence=ECO:0000269|PubMed:18408734 36..39
SUMO interaction motif 2. /evidence=ECO:0000269|PubMed:18408734 46..49 1/2 (50%)
SUMO interaction motif 3. /evidence=ECO:0000269|PubMed:18408734 57..59 1/1 (100%)
SUMO interaction motif 4. /evidence=ECO:0000269|PubMed:18408734 67..70 0/2 (0%)
RING-HC_RNF4 127..183 CDD:438195 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.