DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43058 and rnf4

DIOPT Version :10

Sequence 1:NP_001246302.1 Gene:CG43058 / 12798445 FlyBaseID:FBgn0262360 Length:100 Species:Drosophila melanogaster
Sequence 2:XP_073777547.1 Gene:rnf4 / 557319 ZFINID:ZDB-GENE-041008-246 Length:185 Species:Danio rerio


Alignment Length:78 Identity:26/78 - (33%)
Similarity:37/78 - (47%) Gaps:11/78 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LRSDLGDSDE------PYMCPICMENVRR-----RQPAATPCGHVFCYDCIQKAIGDYKKCPMCN 87
            |.|.|.||..      ...||:||:....     |...:|.|||:||..||:.::.....||.|.
Zfish   108 LLSSLRDSSRARSTPGAISCPVCMDVYSEIMDSGRLMVSTKCGHLFCSQCIRDSLSRAHSCPTCR 172

  Fly    88 KKIMYKQLTRIFL 100
            ||:.:||...|::
Zfish   173 KKLTHKQYHPIYI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43058NP_001246302.1 RING_Ubox 47..99 CDD:473075 20/56 (36%)
rnf4XP_073777547.1 None

Return to query results.
Submit another query.