DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43058 and Brca1

DIOPT Version :10

Sequence 1:NP_001246302.1 Gene:CG43058 / 12798445 FlyBaseID:FBgn0262360 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_036646.2 Gene:Brca1 / 497672 RGDID:2218 Length:1817 Species:Rattus norvegicus


Alignment Length:52 Identity:19/52 - (36%)
Similarity:31/52 - (59%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CPICMENVRRRQPAATPCGHVFCYDCIQKAIGDYK---KCPMCNKKIMYKQL 95
            ||||:|.:  ::|.:|.|.|:||..|:.|.:...|   :||:|..:|..:.|
  Rat    24 CPICLELI--KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNEITKRSL 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43058NP_001246302.1 RING_Ubox 47..99 CDD:473075 19/52 (37%)
Brca1NP_036646.2 RING-HC_BRCA1 6..98 CDD:438161 19/52 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..346
BRCT_assoc 343..504 CDD:463719
Nuclear localization signal. /evidence=ECO:0000255 497..503
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 640..720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 735..768
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 874..907
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 959..982
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1146..1185
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1259..1290
Interaction with PALB2. /evidence=ECO:0000250 1354..1381
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1375..1486
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1498..1534
BRCT_BRCA1_rpt1 1596..1692 CDD:349367
BRCT_BRCA1_rpt2 1703..1800 CDD:349353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.