DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43058 and elfless

DIOPT Version :10

Sequence 1:NP_001246302.1 Gene:CG43058 / 12798445 FlyBaseID:FBgn0262360 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_609860.2 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster


Alignment Length:74 Identity:32/74 - (43%)
Similarity:48/74 - (64%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PVKRLRSDLGDSDE---PYMCPICMENVRRRQPAATPCGHVFCYDCIQKAIGDYKKCPMCNKKIM 91
            |.||::||..:|.:   ||.||:|:|:||.:.|.:|.||||||..||::|:...:.||:|.  :.
  Fly   158 PNKRIKSDDEESKKSVLPYNCPVCLEDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLCG--VD 220

  Fly    92 YKQLTRIFL 100
            ..:..||||
  Fly   221 EPEFHRIFL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43058NP_001246302.1 RING_Ubox 47..99 CDD:473075 21/51 (41%)
elflessNP_609860.2 RING_Ubox 176..>215 CDD:473075 18/38 (47%)

Return to query results.
Submit another query.