DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43218 and obst-B

DIOPT Version :9

Sequence 1:NP_001246864.1 Gene:CG43218 / 12798438 FlyBaseID:FBgn0262854 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:140 Identity:38/140 - (27%)
Similarity:51/140 - (36%) Gaps:41/140 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CSGYYICGDGSYEKVKCPQGLIFDIALNTC-------VLGQCPR---FDGTCSANSTVPPPVTTT 103
            |..:|.|.||.:..:.||.||:|:.....|       |.| |..   ||..|       |.|..:
  Fly   169 CDKFYFCVDGQFNMITCPAGLVFNPKTGICGWPDQVGVTG-CKSEDVFDFEC-------PKVNES 225

  Fly   104 TTTAAPETIPPTPSGPCDNDVTCQLQEKSIPHPTHCRNFYTCY-GKCAVLGLCELGKWFDREGNV 167
            .....|....|       ||               |:.||.|. |.......|:||:.||.|...
  Fly   226 IAVTHPRYADP-------ND---------------CQFFYVCVNGDLPRRNGCKLGQVFDEEKET 268

  Fly   168 CNYSHKVTNC 177
            |:::.||.:|
  Fly   269 CDWARKVPDC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43218NP_001246864.1 CBM_14 34..79 CDD:279884 11/36 (31%)
CBM_14 133..177 CDD:279884 14/44 (32%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884
CBM_14 156..204 CDD:279884 11/34 (32%)
CBM_14 233..278 CDD:279884 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.