DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG18754

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:286 Identity:92/286 - (32%)
Similarity:132/286 - (46%) Gaps:47/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVIISVCQWLC-RFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGT 70
            |.::.||   | ..|:....:..|| :|.|.| |.|  |..:||:..:|||..|..|      ..
  Fly    77 LHMVYVC---CPELGDVLPNKQTCG-QTTPVF-RDR--GAENAELNEYPWMVLLLYE------NR 128

  Fly    71 LITNQFVLTAAHCI---EASKN----LTVRLGGSGLTRSDGSMCQITAE------DYSVSMAIKH 122
            |...::|||||||:   ..::|    .:||||.|   .:|   | ||:|      |..|.....|
  Fly   129 LSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGES---TTD---C-ITSESRCPHLDVEVGQTTVH 186

  Fly   123 KYFTPS--IMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPH 185
            :.||.|  ...||||::||...|::...|:||| :||  ....|:| :.|..:||   |......
  Fly   187 QGFTSSGGTYRNDIALLRLQFPVRYTKKIQPIC-LLD--AEFPLQD-LNLQISGW---DPTKSSQ 244

  Fly   186 LLQEAPITVMNRNVCSKLYDVAITQGQICA-GDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGIT 249
            .|..:.:...|...|...|....:..|:|| |.::.:||.|.||.|:.|::....|......||.
  Fly   245 TLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIA 309

  Fly   250 SFGDIECRS---PSIYTDLSTYSGWI 272
            |:|...|.|   |.:||.:..:|.||
  Fly   310 SYGQQYCYSAGIPGVYTKIGHFSEWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 79/249 (32%)
Tryp_SPc 42..275 CDD:238113 80/250 (32%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 3/9 (33%)
Tryp_SPc 108..338 CDD:238113 80/248 (32%)
Tryp_SPc 108..335 CDD:214473 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.