DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG34409

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:287 Identity:75/287 - (26%)
Similarity:120/287 - (41%) Gaps:70/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIRTMPSFHRTRIIGGSDAEITSHPWMAYL------YNEFHYFCAGTLITNQFVLTAAHCIEAS 87
            |||..     .:|::||..|.....||:..:      .:...:.|:|:||::..::|||||:   
  Fly   242 CGINV-----ESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCV--- 298

  Fly    88 KNLT-------VRLGGSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKF 145
            .||.       ||||.     .||      |..:::...|.|..:......||||::|:..|...
  Fly   299 VNLVSDLELSHVRLGS-----QDG------ATPFAIEQVIVHPNYDQPKYANDIALLRINSTNGT 352

  Fly   146 YDHIRPICIILDPAV----RLLLEDGMTLMATGWGLADKRMHPHL--------LQEAPITVMNRN 198
            :   .|||:..:..:    ||:   |...:|.||.:.....:..:        ::...:.::|..
  Fly   353 F---TPICLPFNGPITLGNRLI---GQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTT 411

  Fly   199 VCSKLY---------DVAITQGQICA-GDKETNTCLGDSGGPL-----GGVVNYYGDLRFVQYGI 248
            .|:..|         .:.||...:|| |....:.|.||||||.     .||....|  |:...||
  Fly   412 SCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSG--RYTIIGI 474

  Fly   249 TSFGDIEC---RSPSIYTDLSTYSGWI 272
            .:||...|   ..|.:||.:|::|.||
  Fly   475 VAFGPTLCGVTTIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 70/273 (26%)
Tryp_SPc 42..275 CDD:238113 71/274 (26%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 70/273 (26%)
Tryp_SPc 252..501 CDD:238113 69/270 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.