DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG34171

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:237 Identity:68/237 - (28%)
Similarity:107/237 - (45%) Gaps:46/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 HYFCAGTLITNQFVLTAAHCIE-------ASKNLTVRLGGSGLTRSDGSMCQITAEDYSVSM--A 119
            ::||.|.::||:.|||:||||.       :.|.:.|.|..| |.::..|      |::.|.:  .
  Fly    54 NHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCAS-LFKTPES------EEFVVDIHNM 111

  Fly   120 IKHKYFTPSIMLNDIAMIRLARTVKF-YDHIRPICIILDPAVRLLLEDGMTLMATG--WGLADKR 181
            |.|.|:..: ..||||:|:|.|.||. ..|:.|:.:     ....||.|......|  :|:..:|
  Fly   112 IIHPYYHRN-QHNDIAIIKLKRYVKLDGHHLAPVVL-----GNSSLEVGNDCKTIGGIFGVRRQR 170

  Fly   182 ---MHPHLLQEAPITVMNRNVCSKLYDVAI-----TQGQICAGDKETNTCLGDSGGPLGGVVNYY 238
               .|..||....:...:.  |.|:....:     .:..||....|...|..|.||||      :
  Fly   171 FGSFHSMLLVNVELRPFDE--CLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPL------F 227

  Fly   239 GDLRFVQYGITSFGDIECRSPS--IYTDLSTYSGWINMVVSQ 278
            .|.:.  ||| :.|.|.|.||.  .::|:|.|:.|:..::|:
  Fly   228 CDGQL--YGI-ALGSINCSSPDPVFFSDVSFYNSWVTKIISE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 66/229 (29%)
Tryp_SPc 42..275 CDD:238113 67/232 (29%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 66/229 (29%)
Tryp_SPc 38..263 CDD:304450 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.