DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG11843

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:302 Identity:90/302 - (29%)
Similarity:129/302 - (42%) Gaps:54/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SVCQWLCRFG--------ESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYL------YN 61
            ||.:....||        |||::: ||...|      ..|:||..|:....|.||.|      .:
  Fly    36 SVFEERIEFGFLLPGASIESRIID-NCRSYT------PLIVGGHPAQPREFPHMARLGRRPDPSS 93

  Fly    62 EFHYFCAGTLITNQFVLTAAHCIEASKN--LTVRLGGSGLTRSDGSMCQITAEDYSVSMAIKHKY 124
            ...:||.|.||:.:||||||||:|:.:.  ..||||.......|.   .....||.|:..|.|..
  Fly    94 RADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDE---DAAPRDYMVAGYIAHPG 155

  Fly   125 FTPSIMLNDIAMIRLARTVKF--YDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHL- 186
            :......:||.:::|...|.|  |.|  |.|:.....     ....:.:|.|||.....:.|.. 
  Fly   156 YEDPQFYHDIGLVKLTEAVVFDLYKH--PACLPFQDE-----RSSDSFIAVGWGSTGLALKPSAQ 213

  Fly   187 LQEAPITVMNRNVCSKLYDVAITQ--------GQICAG-DKETNTCLGDSGGPLGGVVNYYGD-- 240
            |.:..:......||.||....:.:        .|:|.| :...:||.|||||||   :.|:.:  
  Fly   214 LLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPL---LMYHREYP 275

  Fly   241 LRFVQYGITSFGDIECRS---PSIYTDLSTYSGWINMVVSQY 279
            ..:|..||||.| :.|.|   |.|||.:..|.|||...::.:
  Fly   276 CMYVVVGITSAG-LSCGSPGIPGIYTRVYPYLGWIARTLATF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 78/255 (31%)
Tryp_SPc 42..275 CDD:238113 80/257 (31%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 80/257 (31%)
Tryp_SPc 68..309 CDD:214473 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437565
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.