DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG11841

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:265 Identity:89/265 - (33%)
Similarity:129/265 - (48%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TMPSFHRTR--IIGGSDAEITSHPWMAYL-----YNEFHYFCAGTLITNQFVLTAAHCI--EASK 88
            |:.|.|.:|  |:.|:.||....|:.|.|     .||..:||.||||:|:.|||||||.  |..:
  Fly    61 TVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGE 125

  Fly    89 NLTVRLGGSGLTRSDGSMCQITAEDYSVSMAIK-HKYFTPSIMLNDIAMIRLARTVKFYDHIRPI 152
            ...||||.   ...|........||:.| :|:| |..|....:.|||.:::|.|.|||..:..|.
  Fly   126 VNVVRLGE---LEFDTDTDDAEPEDFGV-LALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPA 186

  Fly   153 CIILDPAVRLLLEDGMTLMATGWG---LADKRMHPHL------LQEAPITVMNRNVCSKLYDVAI 208
            |:..|..     |...:.:|.|||   .|.|.....|      .::..::.::.|  .:|.:...
  Fly   187 CLPFDDG-----EQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDAN--DELPNGYE 244

  Fly   209 TQGQICAGDKET-NTCLGDSGGPLGGVVNYYGDLRFVQY--GITSFGDIECRSPSI---YTDLST 267
            .:.|:|.|.::. :||.||||||   |:.|:.||..:.:  ||||.| |.|.:|.|   ||.:..
  Fly   245 PKSQLCIGSRDNKDTCNGDSGGP---VLAYHKDLACMYHVMGITSAG-ITCSTPDIPSAYTRVHY 305

  Fly   268 YSGWI 272
            :..||
  Fly   306 FLNWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 84/255 (33%)
Tryp_SPc 42..275 CDD:238113 85/254 (33%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 85/254 (33%)
Tryp_SPc 72..310 CDD:214473 83/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.