DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG4815

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:286 Identity:67/286 - (23%)
Similarity:109/286 - (38%) Gaps:70/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QWLCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGTLITNQFVL 78
            :|..|| ..|:..   ||:|     ....:||...:         |:|.....|:.||:|.:.:|
  Fly    26 EWTGRF-HPRIYN---GIKT-----TVESLGGVGIQ---------LFNGRKLVCSATLLTPRHIL 72

  Fly    79 TAAHCIEASKNLTVRLGGSGLTRS-----DGSMCQIT--AEDYSVSMAIKHKYFTPSIMLNDIAM 136
            |||||.|            .|.||     .|...:.|  ..:::.:..|:.:.......:..||.
  Fly    73 TAAHCFE------------NLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAKMKFIAD 125

  Fly   137 IRLARTVKF-----YDHIRPICIILDPAVRLLLEDGMTLMATGWGLAD---KRMHPHLLQEAPIT 193
            :.:|:| |:     |.....:|       |.:|.....|:|.|||...   ........:...:.
  Fly   126 VAVAKT-KYPLRSKYIGYAQLC-------RSVLHPRDKLIAAGWGFEGGVWDESRKKTFRSMKVG 182

  Fly   194 VMNRNVCSKLYDVAITQGQICAGDKETNT-CLGDSGGP--LGGVVNYYGDLRFVQYGITSFGDIE 255
            ::::..|.|..|..:....||||.....| |.||||||  ||..|          .||.:: ..:
  Fly   183 IVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLLGRQV----------CGINTW-TFK 236

  Fly   256 C---RSPSIYTDLSTYSGWINMVVSQ 278
            |   ..|.:|..:..|:.:|...:::
  Fly   237 CGNNEKPDVYMGVRYYAKFIKRTINR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 59/251 (24%)
Tryp_SPc 42..275 CDD:238113 60/253 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 58/249 (23%)
Trypsin 49..256 CDD:278516 57/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.