DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG5909

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:262 Identity:83/262 - (31%)
Similarity:125/262 - (47%) Gaps:23/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NCGIRTMPSFHRTRIIGGSDAEITSHPWMA---YLYNEFHYF-CAGTLITNQFVLTAAHC-IEAS 87
            |||.:..|     ::.||..|.....||:|   |..|:...| |.|:||:.:.:|||||| |:..
  Fly   121 NCGNKGNP-----KVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQP 180

  Fly    88 KNLTVRLGGSGLTRSD--------GSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVK 144
            :.:.||||...|...:        ..:|....|:|.:.....|..:....:.:|:|:|:|.|.||
  Fly   181 EVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVK 245

  Fly   145 FYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKLYDVA-I 208
            ...||:|:|:.:|...:.|..| .:....|||..:|......||:|.||..:.|.|.:.|:.. :
  Fly   246 EKSHIKPVCLPIDQKSQELDFD-QSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKGEV 309

  Fly   209 TQGQICA-GDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIEC--RSPSIYTDLSTYSG 270
            :...||| |....:||.||||||:.....:....|.||||:.|||...|  ..|.::..:.....
  Fly   310 SDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLP 374

  Fly   271 WI 272
            ||
  Fly   375 WI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 77/247 (31%)
Tryp_SPc 42..275 CDD:238113 79/248 (32%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 77/247 (31%)
Tryp_SPc 132..379 CDD:238113 79/246 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.