DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG16710

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:294 Identity:98/294 - (33%)
Similarity:147/294 - (50%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PN---CGIRTMPSFHRTRIIGGSDAEITSHPWMAYL---------YNE-FHYFCAGTLITNQFVL 78
            ||   || ..||::   ||.||.:.:....||||.:         :|| ....|||:||||::||
  Fly    92 PNTQICG-PIMPAY---RIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVL 152

  Fly    79 TAAHCIEASKNLT------VRLGGSGLTRSDGSMCQITAEDY--------SVSMAIKHKYF---- 125
            |||||:    .:|      ||||...:..:...:..|...::        .|.::|||:::    
  Fly   153 TAAHCL----RITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFE 213

  Fly   126 -TPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQE 189
             .|   .||||::||...|::...|:|||:.||............|...||||:.|:.:.::|.:
  Fly   214 ERP---YNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQ 275

  Fly   190 APITVMNRNVCSKLYDVAI---TQGQICAGDKETN-TCLGDSGGPLGGVVNYYGDLRFVQY-GIT 249
            |.:...|.:.|| |.:.::   .:..||||:...| ||.|||||||..::. .||..||.. |||
  Fly   276 AYVNGRNADECS-LSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIME-RGDEEFVYLAGIT 338

  Fly   250 SFGDIEC-RSPSIYTDLSTYSGWI--NMVVSQYR 280
            |:|..:| ..|:.||..|.:..||  ||..:.::
  Fly   339 SYGYSQCGYGPAAYTKTSKFVEWILWNMYTNIFQ 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 88/265 (33%)
Tryp_SPc 42..275 CDD:238113 90/269 (33%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 88/265 (33%)
Tryp_SPc 106..362 CDD:238113 87/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.