DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG31219

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:297 Identity:94/297 - (31%)
Similarity:139/297 - (46%) Gaps:46/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WLCRFGESRLLEPNCGIRTMP-------SFHRTRIIGGSDAEITSHPWMAYLYN------EFHYF 66
            ||. ||: |:..|..|.| :|       |....|::|||:|....:||||.|..      |...|
  Fly    58 WLL-FGQ-RICCPPPGNR-LPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPF 119

  Fly    67 CAGTLITNQFVLTAAHCIEA-SKNL---TVRLGGSGLT---------RSDGSMCQITAEDYSVSM 118
            |||:||.|::|||:|||:.. .::|   :||||...:|         |...:.|.:...:..:..
  Fly   120 CAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEK 184

  Fly   119 AIKHKYFTPSIMLN---DIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADK 180
            .|.|..|:.....|   |||::||...|::...|.||||   |......:..:.:  .|||..::
  Fly   185 IIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICI---PKHGFFAKSKLEI--AGWGKTNE 244

  Fly   181 RMHPHLLQEAPITVMNRNVCSKLYD-VAITQG-QICAGDKE-TNTCLGDSGGPLGGVVNYYGDLR 242
            .....:|....|...:..||:..:. :.:.|. |||||..: .:||.|||||||  :|.......
  Fly   245 GQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPL--MVTMDNSSV 307

  Fly   243 FVQYGITSFGDIECRS---PSIYTDLSTYSGWINMVV 276
            ::. |||::|...|..   |.|||..|.:..||..|:
  Fly   308 YLA-GITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 81/258 (31%)
Tryp_SPc 42..275 CDD:238113 82/260 (32%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 81/258 (31%)
Tryp_SPc 90..342 CDD:238113 82/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.