DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG5246

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:304 Identity:78/304 - (25%)
Similarity:128/304 - (42%) Gaps:74/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVIISVCQWLCRFGESRLLEPNCGIRTMPSFHR--------------TRIIGGSDAEITSHPWMA 57
            ||:|||.          ::...|..::: ..||              ||:|||.|:.....|:..
  Fly     4 LVLISVL----------VILSQCSAKSV-KIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQV 57

  Fly    58 YLYNEF-HYFCAGTLITNQFVLTAAHCIE-ASKNLTVRLGGSGLTRS------DGSMCQITAEDY 114
            .:.|.| .:.|.|::|..|::||||||:| ..:.|.:..|....||.      |||....:.:  
  Fly    58 SIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHD-- 120

  Fly   115 SVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLAD 179
                  |..|.      ||||:|..|:.:.:.|..:||.:....:   |.:.|..|..||||...
  Fly   121 ------KPAYH------NDIALIHTAKPIVYDDLTQPIKLASKGS---LPKVGDKLTLTGWGSTK 170

  Fly   180 K-RMHPHLLQEAPITVMNRNVCSKLYDVA--ITQGQICAGDKE-TNTCLGDSGGP-------LGG 233
            . ..:...||:..:..::.:.|......|  :::|.:|...:| ..:|.||||||       |.|
  Fly   171 TWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVG 235

  Fly   234 VVNYYGDLRFVQYGITSFGDIECRSPSIYTDLSTYSGWINMVVS 277
            ||| :|:...:.|            |.::..::.|..||..:::
  Fly   236 VVN-WGEACAIGY------------PDVFGSVAYYHDWIEQMMT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 67/249 (27%)
Tryp_SPc 42..275 CDD:238113 68/251 (27%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 67/249 (27%)
Tryp_SPc 42..263 CDD:238113 68/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.