DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG17475

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:260 Identity:68/260 - (26%)
Similarity:111/260 - (42%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RTRIIGGSDAEITSHPWMAYLYNEF-HYFCAGTLITNQFVLTAAHCIEASKNLTVRL--GGSGLT 100
            :.|:|.|.|.::....:...|...: .:.|.|.:|..:.|||||||:.......:|:  |.....
  Fly    47 QNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYE 111

  Fly   101 RSDGSM--------CQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILD 157
            :.|...        |...:.||.                ||||:|||..|:||.::.:|..:...
  Fly   112 KPDAVYFVEEHWIHCNYNSPDYH----------------NDIALIRLNDTIKFNEYTQPAELPTA 160

  Fly   158 PAVRLLLEDGMTLMATGWGLADK-RMHPHLLQEAPITVMNRNVCSKLYDVAITQG--QIC---AG 216
            |     :.:|..|:.||||..:. ...|.:||:|.:|.:..:.|.::.:...:.|  .||   .|
  Fly   161 P-----VANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTG 220

  Fly   217 DKETNTCLGDSGGPL--GGVVNYYGDLRFVQYGITSFGDIECR--SPSIYTDLSTYSGWINMVVS 277
            .:  ..|.|||||||  .||:          ||:.::| ..|.  .|..:.::..|..||..::|
  Fly   221 GQ--GACHGDSGGPLTHNGVL----------YGLVNWG-YPCALGVPDSHANVYYYLEWIRSMIS 272

  Fly   278  277
              Fly   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 65/251 (26%)
Tryp_SPc 42..275 CDD:238113 66/253 (26%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 65/251 (26%)
Tryp_SPc 50..269 CDD:238113 66/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.