DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG17477

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:300 Identity:69/300 - (23%)
Similarity:114/300 - (38%) Gaps:71/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSAAFLVIISVCQWLCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEF-H 64
            |..|.||..|.|...|           .|.:..:..|    |:||.:|.....|:...|.... .
  Fly     1 MSLARFLFYILVFSSL-----------YCDLLALEHF----IVGGQNAAEGDAPYQVSLQTLLGS 50

  Fly    65 YFCAGTLITNQFVLTAAHCIEA--SKNL-----TVRLGGSGLTRSDGSMCQITAEDYSVSMAIKH 122
            :.|.|.:|::::::||.||::.  :..|     |:|....|            |..|..::.:..
  Fly    51 HLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG------------AVYYPDAIYLHC 103

  Fly   123 KYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKR-MHPHL 186
            .|.:|... |||.::.|..::.|....:.:.:...|..|...|    |:.||||..... ..|..
  Fly   104 NYDSPKYQ-NDIGLLHLNESITFNALTQAVELPTSPFPRGASE----LVFTGWGSQSAAGSLPSQ 163

  Fly   187 LQEAPITVMNRNVCSKLY----DVAITQGQICAGDKETN--TCLGDSGGP------LGGVVNYYG 239
            ||......:|...|..:.    |:.:....||| .::.|  .|.||||||      |.|::|:: 
  Fly   164 LQRVQQQHLNSPACESMMSAYEDLELGPCHICA-YRQANIGACHGDSGGPLVHQGTLVGILNFF- 226

  Fly   240 DLRFVQYGITSFGDIECRS--PSIYTDLSTYSGWINMVVS 277
                          :.|..  |.|:.::..|..|:...:|
  Fly   227 --------------VPCAQGVPDIFMNIMYYRDWMRQTMS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 58/253 (23%)
Tryp_SPc 42..275 CDD:238113 59/255 (23%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 59/255 (23%)
Tryp_SPc 27..246 CDD:214473 58/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.