DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG31326

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:272 Identity:73/272 - (26%)
Similarity:106/272 - (38%) Gaps:72/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IIGGSDAEITSHPWMAYLY-----NEFHYFCAGTLITNQFVLTAAHCIEA------SKNLTVRLG 95
            |..|...:....||:..::     |...:.|.||||:...||:||||..|      :..|.|.||
  Fly   274 IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLG 338

  Fly    96 GSGLT-RSDGSMCQITAEDYSVSMAIKH-----KYFTPSIMLNDIAMIRLARTVKFYDHIRPICI 154
            .:.|. .|||       |...||..|.|     |.||.:    |:|::||...|::.|:|.||| 
  Fly   339 RNTLAIHSDG-------EFRGVSQLIIHENFQFKQFTEA----DLALVRLDEPVRYTDYIVPIC- 391

  Fly   155 ILDPAVRLLLEDGMTLMATGWG---------LADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQ 210
            :...:.|:.|..|:.....|||         ...|....:::.||       |...:|..|.:..
  Fly   392 LWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEA-------NCALELPHVLVQP 449

  Fly   211 GQICAGDKETNTCLGDSGGPL---------------GGVVNYYGDLRFVQYGITSFGDIECRSPS 260
            ..:||.......|..|.||||               |||:|            ......|...||
  Fly   450 SSLCAKKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVIN------------EKENTCELSKPS 502

  Fly   261 IYTDLSTYSGWI 272
            ::||::.:..|:
  Fly   503 VFTDVAKHIEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 72/270 (27%)
Tryp_SPc 42..275 CDD:238113 73/272 (27%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 72/269 (27%)
Tryp_SPc 277..514 CDD:214473 71/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.