DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG9649

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:287 Identity:79/287 - (27%)
Similarity:125/287 - (43%) Gaps:77/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CG----IRTMPSFHRTRIIGGSDAEITSHPWMAYLY----NEFHYFCAGTLITNQFVLTAAHCIE 85
            ||    |:| |..|     .|.:.|....||||.|:    .::::.|.||||:.:.|::||||..
  Fly   246 CGREKVIQT-PFIH-----NGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFR 304

  Fly    86 -ASKNL-----TVRLGGSGLTR-SDGSMCQITAEDYSVSMAIKHKYFTPSIMLN-DIAMIRLART 142
             .|:||     .|.||.:.|.. |.|:       ...|:..:.|:.:.|::..: |:|:::|:..
  Fly   305 FGSRNLPGERTIVSLGRNSLDLFSSGA-------TLGVARLLIHEQYNPNVYTDADLALLQLSNH 362

  Fly   143 VKFYDHIRPICIILDPAVRLLLE--DGMTLMATGWGLADKRMHPHLLQEAPITVMNRNV-CSKLY 204
            |...|:|:|||:..:   ..|||  .|......|||..:|.              |||. .:|:.
  Fly   363 VDIGDYIKPICLWNE---NFLLELPSGHKSYVAGWGEDEKG--------------NRNTRLAKMT 410

  Fly   205 DV------------------AITQGQICAGDKE-TNTCLGDSGGPLGGVVNYYGDLRFVQYGITS 250
            |.                  .||...|||.:.: :..|.||||   ||::....|:..:: |:.|
  Fly   411 DTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSG---GGLMLQEQDIWMLR-GVVS 471

  Fly   251 FGD-----IECRSPSIYTDLSTYSGWI 272
            .|.     .....|.||||::.:..|:
  Fly   472 AGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 72/269 (27%)
Tryp_SPc 42..275 CDD:238113 73/270 (27%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 73/273 (27%)
Tryp_SPc 259..497 CDD:214473 72/265 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.