DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG8870

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:297 Identity:92/297 - (30%)
Similarity:125/297 - (42%) Gaps:58/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VCQWLCRFGESRLLEPNCG-IRTMPSFHRTRIIGGSDAEITSHPWMA-YLYNEFHYF-------C 67
            ||   |...|:.|....|| .|..|:       .|....:...|||| .||...:..       |
  Fly    63 VC---CPKWETYLPHDTCGQSRRKPT-------KGKIPALNEFPWMAMLLYGNKNNLSQKLVPKC 117

  Fly    68 AGTLITNQFVLTAAHCIE--------ASKNLTVRLGGSGL-TRSDGSMCQITAE------DYSVS 117
            .|:||.|.:|||||||:|        |.|  |||||.... |..|.::.....:      :..|.
  Fly   118 GGSLINNWYVLTAAHCVEYPFMDYPYALK--TVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVD 180

  Fly   118 MAIKHKYFTPS-IMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKR 181
            ..|.|:.|... .::||||::||...|::...|:|||:   |..:.|........|:||....:.
  Fly   181 QIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICL---PRAQKLAAHKRKFQASGWPDMGQG 242

  Fly   182 MHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAGDKETN-TCLGDSGGPL------GGVVNYYG 239
            :...:|..:.|...:.:||...||..: ..|||||..:.| |..|||||||      |.|...|.
  Fly   243 IASEVLLRSFIAERHPDVCKSNYDFNL-GSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYA 306

  Fly   240 DLRFVQYGITSFGDIEC----RSPSIYTDLSTYSGWI 272
                  .||.|:|...|    ..|:.||..|.:..||
  Fly   307 ------AGIISYGQKPCVLKTCKPAFYTKTSYFFEWI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 81/265 (31%)
Tryp_SPc 42..275 CDD:238113 83/266 (31%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 82/257 (32%)
Tryp_SPc 93..337 CDD:214473 80/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.