DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and snk

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:272 Identity:83/272 - (30%)
Similarity:129/272 - (47%) Gaps:43/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIRTMPSFHRTRIIGGSDAEITSHPWMAYL---------YNEFHYFCAGTLITNQFVLTAAHCIE 85
            |.:.:||.  ..|:||:.......|.||.|         ..:..:.|.|.|::..:|||||||..
  Fly   176 GKQCVPSV--PLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCAT 238

  Fly    86 ASKNL--TVRLGGSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDH 148
            :....  .||||...|..:..     |.:|..:.:.:.|..:..|...:|||:::|.|.|||.:.
  Fly   239 SGSKPPDMVRLGARQLNETSA-----TQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQ 298

  Fly   149 IRPICIILDPAVRLLLEDGMTLMATGWG----LADKRMHPHLLQEAPITVMNRNVCSKLY----- 204
            :||.|:...|.:::     .|::|.|||    |..|   .:.|::..:.|:.:..|.::|     
  Fly   299 VRPACLWQLPELQI-----PTVVAAGWGRTEFLGAK---SNALRQVDLDVVPQMTCKQIYRKERR 355

  Fly   205 -DVAITQGQICAG--DKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIEC---RSPSIYT 263
             ...|.:||.|||  ....:||.||||||:..::..|..:.|| .||||||.. |   .:|.:||
  Fly   356 LPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFV-VGITSFGKF-CAAPNAPGVYT 418

  Fly   264 DLSTYSGWINMV 275
            .|.:|..||..:
  Fly   419 RLYSYLDWIEKI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 78/256 (30%)
Tryp_SPc 42..275 CDD:238113 80/258 (31%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 80/258 (31%)
Tryp_SPc 186..427 CDD:214473 78/255 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.