DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG13318

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:292 Identity:80/292 - (27%)
Similarity:116/292 - (39%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFH-YFCAGTLITNQFVLTA 80
            |:.|..:     ||.|..|....|....| .|...::||.|.|..... |...|.|||.|.||||
  Fly   144 CQAGSYQ-----CGRRFPPPPGSTTAAPG-QASFGAYPWQAALLTTADVYLGGGALITAQHVLTA 202

  Fly    81 AHCIEASKNLT---VRLG-GSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLAR 141
            ||.: .:..||   |||| ....:.|:    .|.|:|..:|....:..|.|:.:.||:|:::|:.
  Fly   203 AHKV-YNLGLTYFKVRLGEWDAASTSE----PIPAQDVYISNVYVNPSFNPNNLQNDVAILKLST 262

  Fly   142 TVKFYDH--IRPICIILDPAVRLLLEDGMTLMATGWGLAD----------KRMHPHLLQEAPITV 194
            .|.....  :..:|:   |....:   |......|||..|          :|.     .:.|: :
  Fly   263 PVSLTSKSTVGTVCL---PTTSFV---GQRCWVAGWGKNDFGATGAYQAIERQ-----VDVPL-I 315

  Fly   195 MNRNVCSKLYDVAITQGQ---------ICA-GDKETNTCLGDSGGPL----GGVVNYYGDLRFVQ 245
            .|.|..:.|.  |...|.         ||| |:...:.|.||.|.||    .||....|   .|.
  Fly   316 PNANCQAALQ--ATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNGVWYVVG---LVA 375

  Fly   246 YGITSFGDIECRSPSIYTDLSTYSGWINMVVS 277
            :||   |..:...|.:|.::.||..||...::
  Fly   376 WGI---GCAQAGVPGVYVNVGTYLPWIQTTLT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 71/261 (27%)
Tryp_SPc 42..275 CDD:238113 73/263 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 72/257 (28%)
Tryp_SPc 169..399 CDD:214473 70/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.