DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and Jon74E

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:260 Identity:77/260 - (29%)
Similarity:117/260 - (45%) Gaps:50/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIIGGSDAEITSHPWMAYLY----NEFHYFCAGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTR 101
            ||.||..|.....|:...|.    |:.:.:|..:||:::::||||||:|.:..:|..|||. |..
  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGV-LRL 94

  Fly   102 SDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLE- 165
            :...:.:.|..:..:     |..:....:.||||::||.......|.||||.:   |.:..... 
  Fly    95 APRQLIRSTNPEVHL-----HPDWNCQSLENDIALVRLPEDALLCDSIRPIRL---PGLSSSRNS 151

  Fly   166 -DGMTLMATGWG--------LADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQIC---AGDK 218
             |.:..:|:|||        ::|...:.:...|:     |.: |...| ..|....||   .|.|
  Fly   152 YDYVPAIASGWGRMNDESTAISDNLRYVYRFVES-----NED-CEYSY-ANIKPTNICMDTTGGK 209

  Fly   219 ETNTCLGDSGGPLGGVVNYYGDLRFVQ-----YGITSFGDIE-CRS--PSIYTDLSTYSGWINMV 275
              :||.|||||||     .|.|.  ||     .|:||:|... |..  ||::|.::.|..||..|
  Fly   210 --STCTGDSGGPL-----VYSDP--VQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEV 265

  Fly   276  275
              Fly   266  265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 74/255 (29%)
Tryp_SPc 42..275 CDD:238113 75/257 (29%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.