DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG18180

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:247 Identity:68/247 - (27%)
Similarity:105/247 - (42%) Gaps:40/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIIGGSDAEITSHPWMAYLY-----NEFHYFCAGTLITNQFVLTAAHCIEASKNLTVRLGGS-GL 99
            ||:.|..|.....|::..|:     :......|||:|.|.::||||||: ....:.:..|.: |.
  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCL-TGDYVEIHYGSNWGW 98

  Fly   100 TRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLL 164
               :|:..|....|..:|    |..: ||....||.:||... |.|...|..|.:   |::....
  Fly    99 ---NGAYRQTVRRDNFIS----HPDW-PSQGGRDIGLIRTPH-VDFNGLINKIPL---PSMNEQN 151

  Fly   165 E--DGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAGDKET------N 221
            :  .....:|.|||..|.......||...:.:::.:.|.:.|      |.:.:.|..|      :
  Fly   152 DRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAY------GSVASTDMCTRHADGKS 210

  Fly   222 TCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECR-SPSIYTDLSTYSGWI 272
            .|.|||||||    ..:.:.|.|  |:.:|..:.|. .||.||.:|.|..||
  Fly   211 VCGGDSGGPL----VTHDNARLV--GVITFASVSCHDGPSGYTRVSDYLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 66/245 (27%)
Tryp_SPc 42..275 CDD:238113 67/246 (27%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 66/245 (27%)
Tryp_SPc 36..259 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435832
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.