DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG8329

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:263 Identity:71/263 - (26%)
Similarity:110/263 - (41%) Gaps:62/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HRTRIIGGSDAEITSHPWMAY---------LYNEFHYFCAGTLITNQFVLTAAHCIEASKNLTVR 93
            :||...||...:|..:.:.||         |.........|::|.|.:|||||||: .:.::|:.
  Fly    22 NRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCL-TTDSVTIH 85

  Fly    94 LGGSGLTRSDGSMCQITAEDYSVSMAIKHKYFT----PSIMLNDIAMIRLARTVKFYDHIRPICI 154
            .|.:   |:.....|.|..        |:.:|.    |:...:||.:|| ...|.|.:.|..:.:
  Fly    86 YGSN---RAWNGQLQHTVN--------KNNFFRHPGYPNSAGHDIGLIR-TPYVSFTNLINKVSL 138

  Fly   155 ILDPAVRLLLE--DGMTLMATGW------GLADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQG 211
               |......|  :....:|.||      ||||      .||...:.|::...|::.|      |
  Fly   139 ---PKFSQKGERFENWWCVACGWGGMANGGLAD------WLQCMDVQVISNGECARSY------G 188

  Fly   212 QICAGDKET------NTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRS-PSIYTDLSTYS 269
            .:.:.|..|      :.|.|||||.|   |.:...   :|.|:.:|..|.|:| ||.||.:|.:.
  Fly   189 SVASTDMCTRATDGKSVCGGDSGGAL---VTHDNP---IQVGVITFASIGCKSGPSGYTRVSDHL 247

  Fly   270 GWI 272
            .||
  Fly   248 DWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 67/258 (26%)
Tryp_SPc 42..275 CDD:238113 69/259 (27%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 66/250 (26%)
Tryp_SPc 35..250 CDD:214473 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.