DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG10469

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:73/250 - (29%)
Similarity:117/250 - (46%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIIGGSDAEITSHPWMAYLYNEFH------YFCAGTLITNQFVLTAAHCIEASK-NLTVRLGGSG 98
            ||:.|:.|:....|:...|...|.      ..|.||:::|::::|||||::..| ||...|...|
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87

  Fly    99 LTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLL 163
            ..:|......:....|:    |.||.|....:.||||:|:|.:.:.|..:|:|..:   |:.:..
  Fly    88 KVKSFDDKEIVVNRSYT----IVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKL---PSAKKT 145

  Fly   164 LEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKLYD--------VAITQGQICAGDKET 220
            . .|...:.:||||..|::...:||.....:::...|.:.::        ..:..|.||...|:.
  Fly   146 Y-TGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKG 209

  Fly   221 NTCLGDSGGPLGGVVNYYGDLRFVQYGITSFG-DIEC--RSPSIYTDLSTYSGWI 272
            ..|.||||||:   |...|....|  ||.|.| |.||  :.|.:.|.:|:|..||
  Fly   210 LPCRGDSGGPM---VLDDGSRTLV--GIVSHGFDGECKLKLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 71/248 (29%)
Tryp_SPc 42..275 CDD:238113 71/248 (29%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 71/248 (29%)
Tryp_SPc 24..260 CDD:238113 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.