DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG10477

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:244 Identity:70/244 - (28%)
Similarity:117/244 - (47%) Gaps:30/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIIGGSDAEITSHPW---MAYLYNEFHYFCAGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRS 102
            ||..|:.|.....|:   :::..:...::|.|::|.|.:|||||||.:.:.::|:..|.:  .|:
  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGST--VRT 101

  Fly   103 DGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLED- 166
            ...:    .:..|.|..::|..:..:.:.|||::|: ..:|.|...|..|.:   ||:...... 
  Fly   102 SAKL----KKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIAL---PAIASSYSTY 158

  Fly   167 -GMTLMATGWG-LADKRMHPHL-LQEAPITVMNRNVCSKLY-DVAITQGQICAGD-KETNTCLGD 226
             |.|.:|:||| .:|..:.... ||.|...|:...||.|.: ...:|.|.||... .:.:||.||
  Fly   159 AGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGD 223

  Fly   227 SGGPLGGVVNYYGDLRFVQYGITSF---GDIECRSPSIYTDLSTYSGWI 272
            |||||.        |.....|:|||   ...|..:|:.:|.:::|..||
  Fly   224 SGGPLA--------LNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 68/242 (28%)
Tryp_SPc 42..275 CDD:238113 69/243 (28%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 68/242 (28%)
Tryp_SPc 40..267 CDD:238113 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.