DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and KLKB1

DIOPT Version :10

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:273 Identity:90/273 - (32%)
Similarity:134/273 - (49%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEF---HYFCAGTLITNQFV 77
            ||..|::.:    |..:|     .|||:||:::.....||...|..:.   .:.|.|:||.:|:|
Human   385 LCNTGDNSV----CTTKT-----STRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWV 440

  Fly    78 LTAAHCIEASKNLTV-RLGGSGLTRSDGSMCQITAED--YSVSMAIKHKYFTPSIMLNDIAMIRL 139
            ||||||.:......| |:....|..||     ||.:.  ..:...|.|:.:..|...:|||:|:|
Human   441 LTAAHCFDGLPLQDVWRIYSGILNLSD-----ITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKL 500

  Fly   140 ARTVKFYDHIRPICIILDPAVRLLLEDGMTL----MATGWGLA-DKRMHPHLLQEAPITVMNRNV 199
            ...:.:.:..:|||:   |:    ..|..|:    ..||||.: :|....::||:..|.::....
Human   501 QAPLNYTEFQKPICL---PS----KGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEE 558

  Fly   200 CSKLY-DVAITQGQICAGDKE--TNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECR--SP 259
            |.|.| |..|||..:|||.||  .:.|.|||||||  |..:.|..|.|  ||||:|:...|  .|
Human   559 CQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPL--VCKHNGMWRLV--GITSWGEGCARREQP 619

  Fly   260 SIYTDLSTYSGWI 272
            .:||.::.|..||
Human   620 GVYTKVAEYMDWI 632

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 42..275 CDD:238113 83/247 (34%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519