DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG12133

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:308 Identity:95/308 - (30%)
Similarity:142/308 - (46%) Gaps:45/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIISVCQWLC--RFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHY----- 65
            ::.:.|..:.  :..:||:    || ::.||.:   |:||.:|:....||...|..|.:.     
  Fly    34 MVFTCCPMVAGDKLPDSRV----CG-QSPPSSY---IVGGMEAQSNQFPWTVLLGYEAYTAKQRP 90

  Fly    66 --FCAGTLITNQFVLTAAHCIEASKNLT--VRLGGSGLTRSD--------GSMCQITAE-DYSVS 117
              .|||:||.:::|||||||:..:....  ||||... |.:|        |:.....|. |..|.
  Fly    91 SPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEHD-TENDPDYTWLPNGAKIWAPAHVDIDVD 154

  Fly   118 MAIKH-KYFTPS-IMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLED--GMTLMATGWGLA 178
            :.:.| :|:|.: ...||||::||...||:...||||||.  |.:.|....  .......|||.:
  Fly   155 LRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIW--PGIELSTSSFKNFPFQIAGWGDS 217

  Fly   179 DKRMHPHLLQEAPITVMNRNVCSKLYDVAITQG--QICA-GDKETNTCLGDSGGPLGGVVNYYGD 240
            ..:....:|::..|:.|:.:.|...|...:...  |||| |...|:|.|||||.||...|....|
  Fly   218 GLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGAD 282

  Fly   241 LRFVQYGITSFGDIECR---SPSIYTDLSTYSGW----INMVVSQYRK 281
            ..:...||||:|.....   .|::||..|:|..|    ||.:....||
  Fly   283 QFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKINDIAEDERK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 84/262 (32%)
Tryp_SPc 42..275 CDD:238113 86/264 (33%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 84/260 (32%)
Tryp_SPc 62..317 CDD:214473 83/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.