DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and Jon44E

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:292 Identity:83/292 - (28%)
Similarity:130/292 - (44%) Gaps:49/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSAAFLVIISVCQWLCRFGESRLLEPNCGIRTMPSFHRT--RIIGGSDAEITSHPWMAYL-YNE 62
            ||...||..::|........||....|   ::.||...:.  ||..|..|.....|::..| :|:
  Fly     1 MKLFVFLACLAVASAGVVPSESARAVP---VKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFND 62

  Fly    63 FHYFCAGTLITNQFVLTAAHCIEASKNLTVRLGGS---------GLTRSDGSMCQITAEDYSVSM 118
            ..|:|.|::|.:.:|||||||..::.::.:..|.|         .::|||               
  Fly    63 GGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSRSD--------------- 112

  Fly   119 AIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAV--RLLLEDGMTLMATGWGLADKR 181
            .|:|..:. ..:.||||:||:.. |.|:..:..:.:   |:.  |.....|...:|:||||.|..
  Fly   113 MIQHPDWN-DFLNNDIALIRIPH-VDFWSLVNKVEL---PSYNDRYNSYSGWWAVASGWGLTDNN 172

  Fly   182 M-HPHLLQEAPITVMNRNVCSKLY-DVAITQGQICAG-DKETNTCLGDSGGPLGGVVNYYGDLRF 243
            . ..:.|....:.:::.|.|...| ...||...||.. |...::|.|||||||    ..:.:.|.
  Fly   173 SGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPL----VLHDNNRI 233

  Fly   244 VQYGITSFGDIE-CRS--PSIYTDLSTYSGWI 272
            |  ||.|||..| |.:  |:.:|.::.|..||
  Fly   234 V--GIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 71/248 (29%)
Tryp_SPc 42..275 CDD:238113 72/249 (29%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 71/248 (29%)
Tryp_SPc 41..266 CDD:238113 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.