DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG17572

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:308 Identity:78/308 - (25%)
Similarity:128/308 - (41%) Gaps:71/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CRFGESRL------------------LEPN--CGIRTMPSFHRTRIIGGSDAEITSHPWMAYL-- 59
            |.:|:..|                  ||.|  || :::...|..:.:|       |:|::|.:  
  Fly    92 CYYGDKSLYCGGSSEELPYVCCPSSPLEKNQVCG-KSLVQGHFYKGLG-------SYPFVARIGF 148

  Fly    60 ----YNEFHYFCAGTLITNQFVLTAAHCIEASKN----LTVRLGGSGLTRSD-----GSMCQITA 111
                ...|.|.|||.:|..:.:||||||..|..:    .:||:|... |.||     ...|...:
  Fly   149 KHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYD-TSSDPDCANTGFCAPRS 212

  Fly   112 EDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWG 176
            .::::|..|.|..:......:|||::.|...:.:....:|||:   ...|..|..|......|||
  Fly   213 VNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICL---QKTRANLVVGKRATIAGWG 274

  Fly   177 -LADKRMHPHLLQEAPITVMNRNVCSKLYDVA-------ITQGQ-ICAGDKETNTCLGDSGGPL- 231
             ::...:....:....:.:.:.::|.:.|...       ..:|| :|||.:..:.|.|..|.|| 
  Fly   275 KMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPLF 339

  Fly   232 ---GGVVNYYGDLRFVQYGITSFGDIEC---RSPSIYTDLSTYSGWIN 273
               .|:        |.|.||.|||...|   |.||:||.::.:|.||:
  Fly   340 IQENGI--------FSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWIH 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 67/261 (26%)
Tryp_SPc 42..275 CDD:238113 69/263 (26%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 69/261 (26%)
Tryp_SPc 138..378 CDD:214473 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.