DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and psh

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:260 Identity:75/260 - (28%)
Similarity:115/260 - (44%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IIGGSDAEITSHPWMA---YLYNEFHYFCAGTLITNQFVLTAAHCIEASKNLT--VRLGGSGLTR 101
            |:||...:...:|.||   |:.....:.|.|:||.::||||||||:....|..  ||||...:..
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIEN 208

  Fly   102 SDGSMCQITAEDYSV-SMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICI---ILDPAVRL 162
            .|.|...|......: ...:.:||       ||||::.|.|.|...|:|||.|:   ..||    
  Fly   209 PDHSYQDIVIRSVKIHPQYVGNKY-------NDIAILELERDVVETDNIRPACLHTDATDP---- 262

  Fly   163 LLEDGMTLMATGWGLAD--KRMHPHLLQEAPITVMNRNVCS----------KLYDVAITQGQICA 215
              .........|||:.:  .|....:|..|.:.::..:.|:          :|....:....:||
  Fly   263 --PSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA 325

  Fly   216 GDKE--TNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECR--SPSIYTDLSTYSGWINMVV 276
            .|::  .:.|.|||||||...:| ..|..:...|:.|.| ..|.  :|.:||.:|:|..:|..:|
  Fly   326 IDQKLIADACKGDSGGPLIHELN-VEDGMYTIMGVISSG-FGCATVTPGLYTRVSSYLDFIEGIV 388

  Fly   277  276
              Fly   389  388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 73/254 (29%)
Tryp_SPc 42..275 CDD:238113 74/257 (29%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 73/254 (29%)
Tryp_SPc 144..387 CDD:238113 74/257 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.