DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and Hayan

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:265 Identity:74/265 - (27%)
Similarity:116/265 - (43%) Gaps:48/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IIGGSDAEITSHPWMAYL-YNEF---HYFCAGTLITNQFVLTAAHCIEASKNLT--VRLGGSGLT 100
            |:.|...:...:|.||.: ||.|   .:.|.|:||.::||||||||:.:..:..  ||||...:.
  Fly   385 ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIE 449

  Fly   101 RSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILD----PAVR 161
            ..:.....|...|..:     |..::.|....|||:::||...|..|.|||.|:..|    ||  
  Fly   450 NPEPGYQDINVIDVQI-----HPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPA-- 507

  Fly   162 LLLEDGMTLMATGWGLAD--KRMHPHLLQEAPITVMNRNVCSKLYDV----------AITQGQIC 214
                 .......|||:.:  .|....:|..|.:.::..:.|:..:..          .:...|:|
  Fly   508 -----NYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLC 567

  Fly   215 AGDK--ETNTCLGDSGGPL----GGVVNYYGDLRFVQYGITSFGDIEC--RSPSIYTDLSTYSGW 271
            |.||  ..:.|.|||||||    ..|...|..:..:..|   ||   |  ::|.:||.:|::..:
  Fly   568 AADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSG---FG---CATKTPGLYTRVSSFLDY 626

  Fly   272 INMVV 276
            |..:|
  Fly   627 IEGIV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 72/259 (28%)
Tryp_SPc 42..275 CDD:238113 73/262 (28%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 72/259 (28%)
Tryp_SPc 385..630 CDD:238113 73/262 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.